Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A458

Expression Region

1-97

Origin

Influenza A virus (strain A/Turkey/Wisconsin/1/1966 H9N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRIKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC23B Antibody Blocking peptide
orb1452450 500 µg

SEC23B Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse Monoclonal ORF73/HHV8 Antibody (HHV8/3606) [DyLight 550]
NBP3-08645R 100 µL

Mouse Monoclonal ORF73/HHV8 Antibody (HHV8/3606) [DyLight 550]

Sign In for Pricing
View Details
Goat anti-ELF3 / ERT/ ESX Antibody
dAP-0104 50 µg

Goat anti-ELF3 / ERT/ ESX Antibody

Sign In for Pricing
View Details
MARK2 (MAP/Microtubule affinity-regulating Kinase 2, EMK1, MGC99619, PAR-1, Par1b) (MaxLight 750)
MBS6239342-01 0.1 mL

MARK2 (MAP/Microtubule affinity-regulating Kinase 2, EMK1, MGC99619, PAR-1, Par1b) (MaxLight 750)

Sign In for Pricing
View Details
MARK2 (MAP/Microtubule affinity-regulating Kinase 2, EMK1, MGC99619, PAR-1, Par1b) (MaxLight 750)
MBS6239342-02 5x 0.1 mL

MARK2 (MAP/Microtubule affinity-regulating Kinase 2, EMK1, MGC99619, PAR-1, Par1b) (MaxLight 750)

Sign In for Pricing
View Details
PDX1/Ipf1 Rabbit Monoclonal Antibody
orb547340 100 µL

PDX1/Ipf1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details