Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q0A458

Expression Region

1-97

Origin

Influenza A virus (strain A/Turkey/Wisconsin/1/1966 H9N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRIKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Spryd3 Pre-designed siRNA Set B
SI113776B 1 Each

Mouse Spryd3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Anti Human JUN Monoclonal Clone HDG-10 100ug
IRBAHUJUNHDG10C100ug 100 µg

Rabbit Anti Human JUN Monoclonal Clone HDG-10 100ug

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) SLYX Polyclonal Antibody
MBS7184937 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) SLYX Polyclonal Antibody

Sign In for Pricing
View Details
Olr1739 Protein Vector (Rat) (pPM-C-HA)
PV289124 500 ng

Olr1739 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Apolipoprotein E2 (ApoE2) 1-132 (1.0 mg) Human, Recombinant
AE-120-10 1 mg

Apolipoprotein E2 (ApoE2) 1-132 (1.0 mg) Human, Recombinant

Sign In for Pricing
View Details
SSB (N-Term) Rabbit pAb
MBS8553882-01 0.1 mL

SSB (N-Term) Rabbit pAb

Sign In for Pricing
View Details