Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (NDUFB3)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (NDUFB3) spans the amino acid sequence from region 2-98.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3, Complex I-B12, CI-B12, NADH-ubiquinone oxidoreductase B12 subunit

UniProt

Q0MQD1

Expression Region

2-98

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSV SFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF405S conjugate, 0.1mg/mL
BNC040245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL
BNC801797-100 1x 100 µL

Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF488A conjugate, 0.1mg/mL
BNC881125-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF647 conjugate, 0.1mg/mL
BNC471587-100 1x 100 µL

CD62L (L-Selectin) (LAM1-116), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details