Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (NDUFB3)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 (NDUFB3) spans the amino acid sequence from region 2-98.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3, Complex I-B12, CI-B12, NADH-ubiquinone oxidoreductase B12 subunit

UniProt

Q0MQD1

Expression Region

2-98

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSV SFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT7 shRNA (m) Lentiviral Particles
sc-72947-V 200 µL

CNOT7 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Nicotinamide 1, N6-ethenoadenine dinucleotide
sc-215559 5 mg

Nicotinamide 1, N6-ethenoadenine dinucleotide

Sign In for Pricing
View Details
OR4S1 (NM_001004725) Human Tagged ORF Clone Lentiviral Particle
RC213195L3V 200 µL

OR4S1 (NM_001004725) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VAPEUR6BARS450X52CARD-T1-P14 Pipe Markers for Steam
N003227 2 Card (2 Marker (s) x 1 Card)

VAPEUR6BARS450X52CARD-T1-P14 Pipe Markers for Steam

Sign In for Pricing
View Details
Rabbit Monoclonal CD7 Antibody (CD7/8357R) [FITC]
NBP3-20950F 0.1 mL

Rabbit Monoclonal CD7 Antibody (CD7/8357R) [FITC]

Sign In for Pricing
View Details
Caprine Interleukin 6 (IL6) Mini Samples ELISA Kit
MBS2087214-01 24 Strip Well

Caprine Interleukin 6 (IL6) Mini Samples ELISA Kit

Sign In for Pricing
View Details