Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q20NW0

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Minnesota/945/1980 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (H1 + TS1), CF647 conjugate, 0.1mg/mL
BNC470687-500 1x 500 µL

Cytokeratin 8 (H1 + TS1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FADD (Ab-194) Antibody
8B0425-AAT 50 µg

FADD (Ab-194) Antibody

Sign In for Pricing
View Details
GRB7 (NM_005310) Human Over-expression Lysate
LC401639 20 µg

GRB7 (NM_005310) Human Over-expression Lysate

Sign In for Pricing
View Details
JUN Dye qPCR Calibration Solution *10,000X*
67038-AAT 100 µL

JUN Dye qPCR Calibration Solution *10,000X*

Sign In for Pricing
View Details
MDM2 (MDM2/2414), CF640R conjugate, 0.1mg/mL
BNC402414-100 1x 100 µL

MDM2 (MDM2/2414), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIX1 (NM_005982) Human Over-expression Lysate
LC401814 20 µg

SIX1 (NM_005982) Human Over-expression Lysate

Sign In for Pricing
View Details