Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q20NW0

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Minnesota/945/1980 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab22a (NM_024436) Mouse Tagged ORF Clone
MG201880 10 µg

Rab22a (NM_024436) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GPR161 Human Gene Knockout Kit (CRISPR)
KN215665RB 1 Kit

GPR161 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1B (NM_001764) Human Recombinant Protein
TP319131M 100 µg

CD1B (NM_001764) Human Recombinant Protein

Sign In for Pricing
View Details
Corin Mouse Gene Knockout Kit (CRISPR)
KN503701 1 Kit

Corin Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF568 conjugate, 0.1mg/mL
BNC680732-500 1x 500 µL

TAG-72 / CA72.4 (CC49), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin Conjugated Griffonia simplicifolia Lectin -GS-I-
I-2401-1 1 mg

Ferritin Conjugated Griffonia simplicifolia Lectin -GS-I-

Sign In for Pricing
View Details