Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q20NW0

Expression Region

1-97

Origin

Influenza A virus (strain A/Gull/Minnesota/945/1980 H13N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRSGWECRCNDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYQQEKQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-H-Octafluoropentanoic Acid
TRC-O273148-500MG 500 mg

5-H-Octafluoropentanoic Acid

Sign In for Pricing
View Details
General 5-Hydroxytryptamine (5-HT) ELISA Kit
RDR-5-HT-Ge-01 96 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit

Sign In for Pricing
View Details
General 5-Hydroxytryptamine (5-HT) ELISA Kit
RDR-5-HT-Ge-02 48 Tests

General 5-Hydroxytryptamine (5-HT) ELISA Kit

Sign In for Pricing
View Details
RPS14 (NM_001025071) Human Over-expression Lysate
LC422575 20 µg

RPS14 (NM_001025071) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS713938 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Benzydamine
TRC-B414053-50MG 50 mg

Benzydamine

Sign In for Pricing
View Details