Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q20PM2

Expression Region

1-97

Origin

Influenza A virus (strain A/Grey teal/Australia/2/1979 H4N4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHANK2 Antibody
DF4501-01 100 µL

SHANK2 Antibody

Sign In for Pricing
View Details
SHANK2 Antibody
DF4501-02 200 µL

SHANK2 Antibody

Sign In for Pricing
View Details
PRMT3 (Protein Arginine N-Methyltransferase 3, Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3, HRMT1L3) (FITC)
131837-FITC 100 µL

PRMT3 (Protein Arginine N-Methyltransferase 3, Heterogeneous Nuclear Ribonucleoprotein Methyltransferase-like Protein 3, HRMT1L3) (FITC)

Sign In for Pricing
View Details
Recombinant Mouse BEN domain-containing protein 3 (Bend3) , partial
MBS1314113 Inquire

Recombinant Mouse BEN domain-containing protein 3 (Bend3) , partial

Sign In for Pricing
View Details
Brg-1 (G-7) HRP
sc-17796 HRP 200 µg/mL

Brg-1 (G-7) HRP

Sign In for Pricing
View Details
Abaloparatide acetate
XJA06233 50 mg

Abaloparatide acetate

Sign In for Pricing
View Details