Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q20PM2

Expression Region

1-97

Origin

Influenza A virus (strain A/Grey teal/Australia/2/1979 H4N4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal JPH4 Antibody [DyLight 350]
NBP2-41093UV 0.1 mL

Rabbit Polyclonal JPH4 Antibody [DyLight 350]

Sign In for Pricing
View Details
PQBP1 (NM_001032382) Human Untagged Clone
SC302647 10 µg

PQBP1 (NM_001032382) Human Untagged Clone

Sign In for Pricing
View Details
Ras GTPase-Activating Protein 2 (RASA2) Antibody
abx346235-01 20 µL

Ras GTPase-Activating Protein 2 (RASA2) Antibody

Sign In for Pricing
View Details
Ras GTPase-Activating Protein 2 (RASA2) Antibody
abx346235-02 50 µL

Ras GTPase-Activating Protein 2 (RASA2) Antibody

Sign In for Pricing
View Details
Ras GTPase-Activating Protein 2 (RASA2) Antibody
abx346235-03 100 µL

Ras GTPase-Activating Protein 2 (RASA2) Antibody

Sign In for Pricing
View Details
Ras GTPase-Activating Protein 2 (RASA2) Antibody
abx346235-04 200 µL

Ras GTPase-Activating Protein 2 (RASA2) Antibody

Sign In for Pricing
View Details