Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q20PM2

Expression Region

1-97

Origin

Influenza A virus (strain A/Grey teal/Australia/2/1979 H4N4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Serine/threonine-protein kinase PLK2
E12869h 96 Tests

ELISA Kit For Serine/threonine-protein kinase PLK2

Sign In for Pricing
View Details
KIAA0100 sgRNA CRISPR Lentivector (Human) (Target 3)
K1132404 1.0 µg DNA

KIAA0100 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TRIM74, CT (TRIM74, TRIM50C, Tripartite motif-containing protein 74, Tripartite motif-containing protein 50C) (MaxLight 490) discontinued
043264-ML490 100 µL

TRIM74, CT (TRIM74, TRIM50C, Tripartite motif-containing protein 74, Tripartite motif-containing protein 50C) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse TSTD2 shRNA Plasmid
abx983141-01 150 µg

Mouse TSTD2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TSTD2 shRNA Plasmid
abx983141-02 300 µg

Mouse TSTD2 shRNA Plasmid

Sign In for Pricing
View Details
Human Fibroblast growth factor 16 (FGF16) ELISA kit
CSB-EL008621HU-01 24 Well

Human Fibroblast growth factor 16 (FGF16) ELISA kit

Sign In for Pricing
View Details