Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q2PIM1

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/18/1978 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human IL21 sgRNA gene knockout kit - Lentiviral human IL21 sgRNA gene knockout kit (plasmid)
GTR15390830 1 Vial

Lentiviral human IL21 sgRNA gene knockout kit - Lentiviral human IL21 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Methyl 5-ethoxynicotinate
OR1094520-01 250 mg

Methyl 5-ethoxynicotinate

Sign In for Pricing
View Details
Methyl 5-ethoxynicotinate
OR1094520-02 500 mg

Methyl 5-ethoxynicotinate

Sign In for Pricing
View Details
Methyl 5-ethoxynicotinate
OR1094520-03 1 g

Methyl 5-ethoxynicotinate

Sign In for Pricing
View Details
(2R,5R) -2,5-Dimethylmorpholine hydrochloride
OR1039550 1 Each

(2R,5R) -2,5-Dimethylmorpholine hydrochloride

Sign In for Pricing
View Details
CDCA4 (NM_145701) Human Untagged Clone
SC321153 10 µg

CDCA4 (NM_145701) Human Untagged Clone

Sign In for Pricing
View Details