Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q2PIM1

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/18/1978 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIRE
519933-01 100 µL

AIRE

Sign In for Pricing
View Details
AIRE
519933-02 200 µL

AIRE

Sign In for Pricing
View Details
OR11H2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1556406 1.0 µg DNA

OR11H2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal TEP1 Antibody [DyLight 650]
NBP1-77285C 0.1 mL

Rabbit Polyclonal TEP1 Antibody [DyLight 650]

Sign In for Pricing
View Details
PSMC3 Rabbit Polyclonal Antibody (PE-Cy5)
orb948502 100 µL

PSMC3 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
MIR4259 Protein Vector (Human) (pPM-C-HA)
PV096932 500 ng

MIR4259 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details