Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q2PIK5

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/110/1976 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast, right
CS646620 5x 5 µm

Frozen Tissue Sections, Breast, right

Sign In for Pricing
View Details
Pure Griffonia simplicifolia Lectin -GS-I-A4 -
L-2401-A-1 1 mg

Pure Griffonia simplicifolia Lectin -GS-I-A4 -

Sign In for Pricing
View Details
DCAF4L2 (NM_152418) Human Recombinant Protein
TP761055 50 µg

DCAF4L2 (NM_152418) Human Recombinant Protein

Sign In for Pricing
View Details
CF®488A Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20924-50uL 1x 50 µL

CF®488A Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
KLF1 Polyclonal Antibody
E-AB-19799-01 20 µL

KLF1 Polyclonal Antibody

Sign In for Pricing
View Details
KLF1 Polyclonal Antibody
E-AB-19799-02 60 µL

KLF1 Polyclonal Antibody

Sign In for Pricing
View Details