Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q2PIK5

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/110/1976 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATC (NM_176818) Human Recombinant Protein
TP315964M 100 µg

GATC (NM_176818) Human Recombinant Protein

Sign In for Pricing
View Details
GTF3C4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A1]
TA812628AM 100 µL

GTF3C4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A1]

Sign In for Pricing
View Details
GTF3C5 (Center) Rabbit Polyclonal Antibody
AP51975PU-N 400 µL

GTF3C5 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBP4 Rabbit Polyclonal Antibody
TA380801 100 µL

RBP4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STK39 (NM_013233) Human Over-expression Lysate
LY402227 100 µg

STK39 (NM_013233) Human Over-expression Lysate

Sign In for Pricing
View Details
Galectin 3 Recombinant Rabbit Monoclonal Antibody [JF39-10]
ET1702-48 100 µL

Galectin 3 Recombinant Rabbit Monoclonal Antibody [JF39-10]

Sign In for Pricing
View Details