Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q2PIK5

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/110/1976 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf42 (TSR3) (NM_001001410) Human Over-expression Lysate
LY424339 100 µg

C16orf42 (TSR3) (NM_001001410) Human Over-expression Lysate

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF640R conjugate, 0.1mg/mL
BNC402051-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAFK Human Gene Knockout Kit (CRISPR)
KN423543 1 Kit

MAFK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRAK (IRAK1) (NM_001569) Human Over-expression Lysate
LY400603 100 µg

IRAK (IRAK1) (NM_001569) Human Over-expression Lysate

Sign In for Pricing
View Details
Nicergoline-d3
TRC-N394552-1MG 1 mg

Nicergoline-d3

Sign In for Pricing
View Details
Chpf2 Mouse Gene Knockout Kit (CRISPR)
KN503292 1 Kit

Chpf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details