Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q38SQ7

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/5/1983 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNE1 (IFNE) Human Gene Knockout Kit (CRISPR)
KN222153BN 1 Kit

IFNE1 (IFNE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF594 conjugate, 0.1mg/mL
BNC942332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MICA (NM_001177519) Human Over-expression Lysate
LC432900 20 µg

MICA (NM_001177519) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF568 conjugate, 0.1mg/mL
BNC682043-500 1x 500 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ketotifen Fumarate
TRC-K315100-500MG 500 mg

Ketotifen Fumarate

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP539940 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details