Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q38SQ7

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/5/1983 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3S)-3-Mercapto-1-hexanol
TRC-M374400-100MG 100 mg

(3S)-3-Mercapto-1-hexanol

Sign In for Pricing
View Details
N6-Succinyl Adenosine-D3
TRC-S688826-5MG 5 mg

N6-Succinyl Adenosine-D3

Sign In for Pricing
View Details
C20orf85 (NM_178456) Human Recombinant Protein
TP306670M 100 µg

C20orf85 (NM_178456) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602814 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS703350 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS700312 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details