Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q38SQ7

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/5/1983 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-x (BX006), CF647 conjugate, 0.1mg/mL
BNC470006-500 1x 500 µL

Bcl-x (BX006), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Butyrate-13C4
TRC-S615178-2MG 2 mg

Sodium Butyrate-13C4

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703512 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
NPY5R Recombinant Rabbit Monoclonal Antibody [JE61-56]
HA720061 100 µL

NPY5R Recombinant Rabbit Monoclonal Antibody [JE61-56]

Sign In for Pricing
View Details
HDLBP (Center) Rabbit Polyclonal Antibody
AP52025PU-N 400 µL

HDLBP (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GNG4 (NM_001098722) Human Over-expression Lysate
LY420668 100 µg

GNG4 (NM_001098722) Human Over-expression Lysate

Sign In for Pricing
View Details