Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q463X4

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/102/1972 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF2 (TSPAN7) (NM_004615) Human Over-expression Lysate
LC401460 20 µg

TM4SF2 (TSPAN7) (NM_004615) Human Over-expression Lysate

Sign In for Pricing
View Details
P53 (DO-7), CF594 conjugate, 0.1mg/mL
BNC940513-100 1x 100 µL

P53 (DO-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp22I, 1000U
RE1288 1000 U

Ksp22I, 1000U

Sign In for Pricing
View Details
KRT35 (NM_002280) Human Over-expression Lysate
LY419432 100 µg

KRT35 (NM_002280) Human Over-expression Lysate

Sign In for Pricing
View Details
Imidacloprid-olefin
TRC-I274995-10MG 10 mg

Imidacloprid-olefin

Sign In for Pricing
View Details
ATP6V0A1 Human Gene Knockout Kit (CRISPR)
KN423769 1 Kit

ATP6V0A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details