Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q463X4

Expression Region

1-97

Origin

Influenza A virus (strain A/Memphis/102/1972 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD4 (NM_024722) Human Recombinant Protein
TP306781L 1 mg

ACBD4 (NM_024722) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622617 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
L-Cysteine
TRC-C995000-2.5G 2.5 g

L-Cysteine

Sign In for Pricing
View Details
CDK1 Rabbit Polyclonal Antibody
AP08098PU-N 100 µL

CDK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
TA506176AM 100 µL

Kallikrein 8 (KLK8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgM,  10nm
GM-08-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgM, 10nm

Sign In for Pricing
View Details