Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67166

Expression Region

1-97

Origin

Influenza A virus (strain A/Duck/Czechoslovakia/1956 H4N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECRYSGSSDPLVIAASIIGILHLILWILDRLFFKCIYRCLKHGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RIPK4 activation kit by CRISPRa
GA110060 1 Kit

Human RIPK4 activation kit by CRISPRa

Sign In for Pricing
View Details
SNX33 (NM_153271) Human Recombinant Protein
TP305879M 100 µg

SNX33 (NM_153271) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB623238 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
(2S)-2-Hydroxyglutaric Acid Octyl Ester Sodium Salt
TRC-H942596-5MG 5 mg

(2S)-2-Hydroxyglutaric Acid Octyl Ester Sodium Salt

Sign In for Pricing
View Details
EnzyFluo™ Collagen Assay Kit
ECOL-100 100 Tests

EnzyFluo™ Collagen Assay Kit

Sign In for Pricing
View Details
Uncoated Human NCAD (Neural Cadherin) ELISA Kit
E-UNEL-H0137-01 5x 96 Tests

Uncoated Human NCAD (Neural Cadherin) ELISA Kit

Sign In for Pricing
View Details