Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67186

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Iowa/17672/1988 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCKCNDSSDPLVAVASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COQ7 (NM_016138) Human Recombinant Protein
TP320317M 100 µg

COQ7 (NM_016138) Human Recombinant Protein

Sign In for Pricing
View Details
5-Fluoroindole-3-butyric Acid
TRC-F402818-250MG 250 mg

5-Fluoroindole-3-butyric Acid

Sign In for Pricing
View Details
RING1 Antibody
KC-46211-01 50 μL

RING1 Antibody

Sign In for Pricing
View Details
RING1 Antibody
KC-46211-02 100 µL

RING1 Antibody

Sign In for Pricing
View Details
RING1 Antibody
KC-46211-03 1 mL

RING1 Antibody

Sign In for Pricing
View Details
Zorvec
TRC-Z700555-1MG 1 mg

Zorvec

Sign In for Pricing
View Details