Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67186

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Iowa/17672/1988 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCKCNDSSDPLVAVASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGR2 Mouse Monoclonal Antibody [Clone ID: OTI5E10]
CF809781 100 µg

AGR2 Mouse Monoclonal Antibody [Clone ID: OTI5E10]

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF647 conjugate, 0.1mg/mL
BNC471964-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARHGEF2 Rabbit Monoclonal Antibody [Clone ID: 23GB3675]
TA424525S 20 µL

ARHGEF2 Rabbit Monoclonal Antibody [Clone ID: 23GB3675]

Sign In for Pricing
View Details
JUN Dye qPCR Calibration Solution *10,000X*
67038-AAT 100 µL

JUN Dye qPCR Calibration Solution *10,000X*

Sign In for Pricing
View Details
N2'-Deacetyl-N2'-[3-[(1-ethyl-2,5-dioxo-3-pyrrolidinyl)thio]-1-oxopropyl]-maytansine
TRC-D199030-25MG 25 mg

N2'-Deacetyl-N2'-[3-[(1-ethyl-2,5-dioxo-3-pyrrolidinyl)thio]-1-oxopropyl]-maytansine

Sign In for Pricing
View Details
Recombinant Sulfotransferase 2A1 Antibody
RC-15864-01 50 μL

Recombinant Sulfotransferase 2A1 Antibody

Sign In for Pricing
View Details