Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67211

Expression Region

1-97

Origin

Influenza A virus (strain A/Wisconsin/3523/1988 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCKCNDSSDPLVAAASIIGILHLILWILDRLFLKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha E Recombinant Rabbit Monoclonal Antibody [SN62-06]
ET1611-27 100 µL

Integrin alpha E Recombinant Rabbit Monoclonal Antibody [SN62-06]

Sign In for Pricing
View Details
PDE6 alpha Rabbit Polyclonal Antibody
HA500264 100 µL

PDE6 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
REXO1 Antibody
8C18445-AAT 50 µg

REXO1 Antibody

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF647 conjugate, 0.1mg/mL
BNC472344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 568 Tyramide
45106-AAT 200 Slides

IFluor® 568 Tyramide

Sign In for Pricing
View Details
Guinea pig Interleukin 2 (IL2) ELISA Kit
RD-IL2-Gu-01 96 Tests

Guinea pig Interleukin 2 (IL2) ELISA Kit

Sign In for Pricing
View Details