Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67211

Expression Region

1-97

Origin

Influenza A virus (strain A/Wisconsin/3523/1988 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCKCNDSSDPLVAAASIIGILHLILWILDRLFLKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

U1A (SNRPA) Rabbit Monoclonal Antibody
TA423488 100 µL

U1A (SNRPA) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Synaptotagmin V (SYT5) (NM_003180) Human Over-expression Lysate
LY418847 100 µg

Synaptotagmin V (SYT5) (NM_003180) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-ISOC2
Y058903 100 µg

Anti-ISOC2

Sign In for Pricing
View Details
RNASE9 (NM_001110361) Human Over-expression Lysate
LY426325 100 µg

RNASE9 (NM_001110361) Human Over-expression Lysate

Sign In for Pricing
View Details
TGG2 Mouse Monoclonal Antibody [6H1]
EM1701-93 100 µL

TGG2 Mouse Monoclonal Antibody [6H1]

Sign In for Pricing
View Details
MAGEB4 Mouse Monoclonal Antibody [Clone ID: OTI3H2]
CF809147 100 µg

MAGEB4 Mouse Monoclonal Antibody [Clone ID: OTI3H2]

Sign In for Pricing
View Details