Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPQ1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Shantou/4231/2003 H5N1 genotype V)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HN1 (Hematological and Neurological Expressed 1 Protein, Androgen-regulated Protein 2, ARM2) (PE)
127970-PE 100 µL

HN1 (Hematological and Neurological Expressed 1 Protein, Androgen-regulated Protein 2, ARM2) (PE)

Sign In for Pricing
View Details
IP3 receptor Rabbit pAb, PE-Cy7 conjugated
orb2890929 100 µL

IP3 receptor Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
SERP1 ORF Vector (Human) (pORF)
43434011 1.0 µg DNA

SERP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CD42c/GP1BB Blocking Peptide
MBS9628780-01 1 mg

CD42c/GP1BB Blocking Peptide

Sign In for Pricing
View Details
CD42c/GP1BB Blocking Peptide
MBS9628780-02 5x 1 mg

CD42c/GP1BB Blocking Peptide

Sign In for Pricing
View Details
Fenofibrate
orb1309601-01 100 mg

Fenofibrate

Sign In for Pricing
View Details