Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPQ1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Shantou/4231/2003 H5N1 genotype V)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNEWECRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAT2A Polyclonal Conjugated Antibody
C30410 100 µL

KAT2A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Odorant-binding protein 2a (OBP2A) Human ELISA Kit
F5293 96 Tests

Odorant-binding protein 2a (OBP2A) Human ELISA Kit

Sign In for Pricing
View Details
ACRV1 siRNA (h)
sc-96294 10 µM

ACRV1 siRNA (h)

Sign In for Pricing
View Details
HCFC2 AAV siRNA Pooled Vector
23072161 1.0 µg

HCFC2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
LGI1 Rabbit Polyclonal Antibody
orb585038 100 µL

LGI1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-MSL3 Antibody Picoband
MBS1758557-01 0.01 mg

Anti-MSL3 Antibody Picoband

Sign In for Pricing
View Details