Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPU1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/31.2/2002 H5N1 genotype X1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTGGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR51D1 Antibody
8G621-AAT 50 µg

OR51D1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS636842 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
Tissue Total RNA, Uterus
CR561498 5 µg

Tissue Total RNA, Uterus

Sign In for Pricing
View Details
Cytokeratin 18 Recombinant Mouse monoclonal Antibody
HA610135 100 µg

Cytokeratin 18 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
ZNF426 Rabbit Polyclonal Antibody
TA383564 100 µL

ZNF426 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF740 conjugate, 0.1mg/mL
BNC740041-100 1x 100 µL

Cytokeratin 18 (C-04), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details