Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPU1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/31.2/2002 H5N1 genotype X1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTGGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21WAF1 (Tumor Suppressor Protein) (AC8), Biotin conjugate, 0.1mg/mL
BNCB2378-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trenbolone Enanthate-d13
TRC-T719032-2.5MG 2.5 mg

Trenbolone Enanthate-d13

Sign In for Pricing
View Details
HSPA1L Mouse Monoclonal Antibody [Clone ID: OTI1F12]
CF812114 100 µg

HSPA1L Mouse Monoclonal Antibody [Clone ID: OTI1F12]

Sign In for Pricing
View Details
Chlorosulfonyl Acetic Acid Ethyl Ester
TRC-C384968-250MG 250 mg

Chlorosulfonyl Acetic Acid Ethyl Ester

Sign In for Pricing
View Details
Recombinant C1s Antibody
RC-16528-01 50 μL

Recombinant C1s Antibody

Sign In for Pricing
View Details
Recombinant C1s Antibody
RC-16528-02 100 µL

Recombinant C1s Antibody

Sign In for Pricing
View Details