Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPU1

Expression Region

1-97

Origin

Influenza A virus (strain A/Chicken/Hong Kong/31.2/2002 H5N1 genotype X1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTGGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF48 antibody
FNab09703 100 µg

ZNF48 antibody

Sign In for Pricing
View Details
Ralb Mouse Gene Knockout Kit (CRISPR)
KN514440 1 Kit

Ralb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL
BNC882479-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human alpha Lactalbumin (LALBA) activation kit by CRISPRa
GA102648 1 Kit

Human alpha Lactalbumin (LALBA) activation kit by CRISPRa

Sign In for Pricing
View Details
THYN1 (NM_001037305) Human Over-expression Lysate
LC421944 20 µg

THYN1 (NM_001037305) Human Over-expression Lysate

Sign In for Pricing
View Details
Chk2 (CHEK2) (514-518) Rabbit Polyclonal Antibody
AP26045PU-N 100 µL

Chk2 (CHEK2) (514-518) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details