Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67160

Expression Region

1-97

Origin

Influenza A virus (strain A/Budgerigar/Hokkaido/1/1977 H4N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTKNGWECKCSDSSDPLIIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSVVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyl-PEG4-CH2CO2tBu
sc-496433 250 mg

Benzyl-PEG4-CH2CO2tBu

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (PE)
C2383-23D-01 100 µg

CD31 (PECAM-1, Platelet gpIIa Molecule) (PE)

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (PE)
C2383-23D-02 200 µg

CD31 (PECAM-1, Platelet gpIIa Molecule) (PE)

Sign In for Pricing
View Details
TMPRSS11D Antibody, FITC conjugated
A37052-100UG 100 µg

TMPRSS11D Antibody, FITC conjugated

Sign In for Pricing
View Details
MTTFL sgRNA CRISPR Lentivector (Human) (Target 1)
K1365602 1.0 µg DNA

MTTFL sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
RN5S262 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV744354 1.0 µg DNA

RN5S262 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details