Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67160

Expression Region

1-97

Origin

Influenza A virus (strain A/Budgerigar/Hokkaido/1/1977 H4N6)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTKNGWECKCSDSSDPLIIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSVVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Opoponax oil
HY-N14120 500 mg

Opoponax oil

Sign In for Pricing
View Details
OR4S2 Human shRNA Plasmid Kit (Locus ID 219431)
TL310833 1 Kit

OR4S2 Human shRNA Plasmid Kit (Locus ID 219431)

Sign In for Pricing
View Details
ANKMY1 Polyclonal Antibody, Biotin Conjugated
bs-9744R-Biotin 100 µL

ANKMY1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ATG3, CT (ATG3, APG3, APG3L, Ubiquitin-like-conjugating enzyme ATG3, Autophagy-related protein 3, Protein PC3-96)
MBS644732-01 0.2 mL

ATG3, CT (ATG3, APG3, APG3L, Ubiquitin-like-conjugating enzyme ATG3, Autophagy-related protein 3, Protein PC3-96)

Sign In for Pricing
View Details
ATG3, CT (ATG3, APG3, APG3L, Ubiquitin-like-conjugating enzyme ATG3, Autophagy-related protein 3, Protein PC3-96)
MBS644732-02 5x 0.2 mL

ATG3, CT (ATG3, APG3, APG3L, Ubiquitin-like-conjugating enzyme ATG3, Autophagy-related protein 3, Protein PC3-96)

Sign In for Pricing
View Details
TOMM34 AAV Vector (Human) (CMV)
47292101 1 µg

TOMM34 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details