Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67168

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/Kentucky/2/1986 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSGSSDPLVIAASIIGILHLILWILDRLFFKFIYRLLKYGLK RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHO Antibody (C-term) Blocking Peptide
MBS9222155-01 0.5 mg

RHO Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
RHO Antibody (C-term) Blocking Peptide
MBS9222155-02 5x 0.5 mg

RHO Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Maternal Embryonic Leucine Zipper Kinase (MELK) Peptide
abx269012 100 µg

Maternal Embryonic Leucine Zipper Kinase (MELK) Peptide

Sign In for Pricing
View Details
Dengue virus Mix prM protein IgG Antibody ELISA Kit, Human
VACY-1022-CY137 1 Kit

Dengue virus Mix prM protein IgG Antibody ELISA Kit, Human

Sign In for Pricing
View Details
Hsa-miR-6880-5p miRNA Antagomir
orb1913887-01 10 nmol

Hsa-miR-6880-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6880-5p miRNA Antagomir
orb1913887-02 20 nmol

Hsa-miR-6880-5p miRNA Antagomir

Sign In for Pricing
View Details