Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67207

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Wisconsin/1/1961 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRSEWGCRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MATN1 activation kit by CRISPRa
GA102824 1 Kit

Human MATN1 activation kit by CRISPRa

Sign In for Pricing
View Details
RAB3A Mouse Monoclonal Antibody [Clone ID: OTI1G4]
CF809529 100 µg

RAB3A Mouse Monoclonal Antibody [Clone ID: OTI1G4]

Sign In for Pricing
View Details
UBE2L6 Polyclonal Antibody
RD267611A-01 120 μL

UBE2L6 Polyclonal Antibody

Sign In for Pricing
View Details
UBE2L6 Polyclonal Antibody
RD267611A-02 200 µL

UBE2L6 Polyclonal Antibody

Sign In for Pricing
View Details
3-Buten-1-ol
TRC-B689990-2G 2 g

3-Buten-1-ol

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), Biotin conjugate, 0.1mg/mL
BNCB0737-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (DT101 + BC199), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details