Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67172

Expression Region

1-97

Origin

Influenza A virus (strain A/Equine/Tennessee/5/1986 H3N8)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKCSGSSDPLVIAASIIGILHLILWILDRLFFKFIYRRLKYGLK GGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-6 Microplate Assay Kit
RDSM197 100 Assays

Caspase-6 Microplate Assay Kit

Sign In for Pricing
View Details
POLR2J Antibody
8C15467-AAT 50 µg

POLR2J Antibody

Sign In for Pricing
View Details
SPATA2 (NM_001135773) Human Over-expression Lysate
LY427705 100 µg

SPATA2 (NM_001135773) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TPRX1 activation kit by CRISPRa
GA117130 1 Kit

Human TPRX1 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Amino-2-fluoro-propanoic Acid Hydrochloride
TRC-F587355-25MG 25 mg

3-Amino-2-fluoro-propanoic Acid Hydrochloride

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF405S conjugate, 0.1mg/mL
BNC042477-100 1x 100 µL

MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details