Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67201

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Netherlands/12/1985 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWGCRFSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRLLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Azido-ω-Iodoacetamido PEG
135000-11-5.500MG 500 mg

Ɑ-Azido-ω-Iodoacetamido PEG

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR560898 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF568 conjugate, 0.1mg/mL
BNC682408-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p23 (PTGES3) (NM_006601) Human Over-expression Lysate
LY401975 100 µg

p23 (PTGES3) (NM_006601) Human Over-expression Lysate

Sign In for Pricing
View Details
N,N'-Thiodiphthalimide (>90%)
TRC-N597400-250MG 250 mg

N,N'-Thiodiphthalimide (>90%)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS809136 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details