Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67201

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Netherlands/12/1985 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWGCRFSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRLLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crygf (NM_027010) Mouse Tagged ORF Clone
MG201513 10 µg

Crygf (NM_027010) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL
BNC550809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR43 (FFAR2) (NM_005306) Human Over-expression Lysate
LY401635 100 µg

GPR43 (FFAR2) (NM_005306) Human Over-expression Lysate

Sign In for Pricing
View Details
Human NAT8B activation kit by CRISPRa
GA109822 1 Kit

Human NAT8B activation kit by CRISPRa

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1892), CF647 conjugate, 0.1mg/mL
BNC471892-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
E-EL-M0649-01 24 Tests

Mouse VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details