Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67206

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/29/1937 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRLEYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-2-Aminobutyric-2,3,3,4,4,4-d6 Acid
TRC-A602916-1MG 1 mg

D-2-Aminobutyric-2,3,3,4,4,4-d6 Acid

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR561359 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
L-Phenylalanine
TRC-P319415-50G 50 g

L-Phenylalanine

Sign In for Pricing
View Details
Acvr2b Mouse Gene Knockout Kit (CRISPR)
KN500804 1 Kit

Acvr2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome P450 1A1/1A2 (MC1), CF405S conjugate, 0.1mg/mL
BNC042907-100 1x 100 µL

Cytochrome P450 1A1/1A2 (MC1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vmn1r79 Mouse Gene Knockout Kit (CRISPR)
KN519095 1 Kit

Vmn1r79 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details