Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67206

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/29/1937 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRLEYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL
BNC401729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714452 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), 1mg/mL
BNUM1670-50 1x 50 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), 1mg/mL

Sign In for Pricing
View Details
IKK gamma (IKBKG) (NM_001099857) Human Recombinant Protein
TP318044L 1 mg

IKK gamma (IKBKG) (NM_001099857) Human Recombinant Protein

Sign In for Pricing
View Details
BIRC2 Antibody
KC-7187-01 50 μL

BIRC2 Antibody

Sign In for Pricing
View Details
BIRC2 Antibody
KC-7187-02 100 µL

BIRC2 Antibody

Sign In for Pricing
View Details