Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67206

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/29/1937 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVAAASIIGILHLILWILDRLFFKCIYRRLEYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C6orf62 activation kit by CRISPRa
GA113108 1 Kit

Human C6orf62 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Parkin Antibody
RC-16852-01 50 μL

Recombinant Parkin Antibody

Sign In for Pricing
View Details
Recombinant Parkin Antibody
RC-16852-02 100 µL

Recombinant Parkin Antibody

Sign In for Pricing
View Details
Recombinant Parkin Antibody
RC-16852-03 1 mL

Recombinant Parkin Antibody

Sign In for Pricing
View Details
Carboxylated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB04F4-COOH 10x 96 Well Plates

Carboxylated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL
BNCB1386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details