Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPT7

Expression Region

1-97

Origin

Influenza A virus (strain A/Silky Chicken/Hong Kong/YU100/2002 H5N1 genotype X3)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTGGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-543-5p miRNA Inhibitor
MIR01706 2x 5.0 nmol

rno-miR-543-5p miRNA Inhibitor

Sign In for Pricing
View Details
Adrenomedullin (ADM) Mouse Monoclonal Antibody [Clone ID: LBI2A4]
AMM17600V 100 µL

Adrenomedullin (ADM) Mouse Monoclonal Antibody [Clone ID: LBI2A4]

Sign In for Pricing
View Details
UST4r sgRNA CRISPR Lentivector (Rat) (Target 2)
K7021203 1.0 µg DNA

UST4r sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PCSK5 Rabbit Polyclonal Antibody (HRP)
orb2120576 100 µL

PCSK5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
H-D-Met-OMe.HCl
HY-W014917-01 10 g

H-D-Met-OMe.HCl

Sign In for Pricing
View Details
H-D-Met-OMe.HCl
HY-W014917-02 25 g

H-D-Met-OMe.HCl

Sign In for Pricing
View Details