Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPT7

Expression Region

1-97

Origin

Influenza A virus (strain A/Silky Chicken/Hong Kong/YU100/2002 H5N1 genotype X3)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTGGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZAP 70 (TCR Zeta Associated Protein kinase 70kD) (Biotin)
MBS6242936-01 0.1 mL

ZAP 70 (TCR Zeta Associated Protein kinase 70kD) (Biotin)

Sign In for Pricing
View Details
ZAP 70 (TCR Zeta Associated Protein kinase 70kD) (Biotin)
MBS6242936-02 5x 0.1 mL

ZAP 70 (TCR Zeta Associated Protein kinase 70kD) (Biotin)

Sign In for Pricing
View Details
FRA4B ORF Vector (Human) (pORF)
ORF019794 1.0 µg DNA

FRA4B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PPP1R13B Antibody
A42533-100UL 100 µL

PPP1R13B Antibody

Sign In for Pricing
View Details
MFSD11 CRISPR Knock Out 293T Cell Line (Human)
28451141 1x 10^6 Cells / 1.0 mL

MFSD11 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
PDCL Recombinant Protein Antigen
NBP1-85079PEP 0.1 mL

PDCL Recombinant Protein Antigen

Sign In for Pricing
View Details