Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q6DPT7

Expression Region

1-97

Origin

Influenza A virus (strain A/Silky Chicken/Hong Kong/YU100/2002 H5N1 genotype X3)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRTGWECKCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTGGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cannabipiperidiethanone
T84468-01 10 mg

Cannabipiperidiethanone

Sign In for Pricing
View Details
Cannabipiperidiethanone
T84468-02 50 mg

Cannabipiperidiethanone

Sign In for Pricing
View Details
Lentiviral mouse Hepacam shRNA (UAS) - Lentiviral mouse Hepacam shRNA (UAS, iRFP) (25)
GTR15272798 1 Vial

Lentiviral mouse Hepacam shRNA (UAS) - Lentiviral mouse Hepacam shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Syndecan 1 (E7F7T) Rabbit Monoclonal Antibody
CST 96489T 20 µL

Syndecan 1 (E7F7T) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mkx Rabbit Polyclonal Antibody
TA356070 100 µL

Mkx Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Napsa Pre-designed siRNA Set A
SI209041A 1 Each

Rat Napsa Pre-designed siRNA Set A

Sign In for Pricing
View Details