Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67146

Expression Region

1-97

Origin

Influenza A virus (strain A/Shearwater/Australia/1972 H6N5)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKYSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc15b Mouse Gene Knockout Kit (CRISPR)
KN519412 1 Kit

Wfdc15b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
9-Phenylanthracene
TRC-P308500-2.5G 2.5 g

9-Phenylanthracene

Sign In for Pricing
View Details
Ttc6 Mouse Gene Knockout Kit (CRISPR)
KN500338 1 Kit

Ttc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1 (CD1A) Human Gene Knockout Kit (CRISPR)
KN421599 1 Kit

CD1 (CD1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS702730 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
(S)-(+)-Ibuprofen 2-(Benzyloxy)propan-1-yl Ester
TRC-I140115-25MG 25 mg

(S)-(+)-Ibuprofen 2-(Benzyloxy)propan-1-yl Ester

Sign In for Pricing
View Details