Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67146

Expression Region

1-97

Origin

Influenza A virus (strain A/Shearwater/Australia/1972 H6N5)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPTRNGWECKYSDSSDPLVIAASIIGILHLILWILDRLFFKCIYRRLKYGLK RGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEZ6L2 Antibody
KC-3437-01 50 μL

SEZ6L2 Antibody

Sign In for Pricing
View Details
SEZ6L2 Antibody
KC-3437-02 100 µL

SEZ6L2 Antibody

Sign In for Pricing
View Details
SEZ6L2 Antibody
KC-3437-03 1 mL

SEZ6L2 Antibody

Sign In for Pricing
View Details
Mouse Spertl activation kit by CRISPRa
GA206929 1 Kit

Mouse Spertl activation kit by CRISPRa

Sign In for Pricing
View Details
p53 (TP53) pSer33 Rabbit Polyclonal Antibody
AP01658PU-N 100 µg

p53 (TP53) pSer33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLCO2B1 Rabbit Polyclonal Antibody
TA381722 100 µL

SLCO2B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details