Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67205

Expression Region

1-97

Origin

Influenza A virus (strain A/Swine/Tennessee/24/1977 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRSEWGCRCNDSGDPLVAAASIIGILHLILWILDRLFFKCIHRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIALE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEMT Polyclonal Antibody
E-AB-18144-01 20 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details
PEMT Polyclonal Antibody
E-AB-18144-02 60 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details
PEMT Polyclonal Antibody
E-AB-18144-03 120 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details
PEMT Polyclonal Antibody
E-AB-18144-04 200 µL

PEMT Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS642583 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Human TMEM71 activation kit by CRISPRa
GA115288 1 Kit

Human TMEM71 activation kit by CRISPRa

Sign In for Pricing
View Details