Recombinant Influenza A virus Matrix protein 2 (M)
This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.
Product Specifications
Product Name Alternative
Matrix protein 2, Proton channel protein M2
UniProt
Q67205
Expression Region
1-97
Origin
Influenza A virus (strain A/Swine/Tennessee/24/1977 H1N1)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLLTEVETPIRSEWGCRCNDSGDPLVAAASIIGILHLILWILDRLFFKCIHRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIALE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MGW01F-HB8 50x 96 Well Plates
High Binding 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
Sign In for Pricing
View Details 
