Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V12

Expression Region

1-97

Origin

Influenza A virus (strain A/Aichi/2/1968 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Endothelin-Converting Enzyme 1 (ECE1) ELISA Kit-Sandwich
EK11F478-01 48 Test

Bovine Endothelin-Converting Enzyme 1 (ECE1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Endothelin-Converting Enzyme 1 (ECE1) ELISA Kit-Sandwich
EK11F478-02 96 Tests

Bovine Endothelin-Converting Enzyme 1 (ECE1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
PRPS2, ID (PRPS2, Ribose-phosphate pyrophosphokinase 2, PPRibP, Phosphoribosyl pyrophosphate synthase II) (PE)
MBS6337698-01 0.2 mL

PRPS2, ID (PRPS2, Ribose-phosphate pyrophosphokinase 2, PPRibP, Phosphoribosyl pyrophosphate synthase II) (PE)

Sign In for Pricing
View Details
PRPS2, ID (PRPS2, Ribose-phosphate pyrophosphokinase 2, PPRibP, Phosphoribosyl pyrophosphate synthase II) (PE)
MBS6337698-02 5x 0.2 mL

PRPS2, ID (PRPS2, Ribose-phosphate pyrophosphokinase 2, PPRibP, Phosphoribosyl pyrophosphate synthase II) (PE)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) ELFA Polyclonal Antibody
MBS7148147 Inquire

Rabbit anti-Escherichia coli (strain K12) ELFA Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal EPS15 Antibody (1261C) [Alexa Fluor 647]
FAB8480R 0.1 mL

Rabbit Monoclonal EPS15 Antibody (1261C) [Alexa Fluor 647]

Sign In for Pricing
View Details