Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V12

Expression Region

1-97

Origin

Influenza A virus (strain A/Aichi/2/1968 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pEnCMV-RRM2-SV40-Neo Plasmid
PVT36891 2 µg

pEnCMV-RRM2-SV40-Neo Plasmid

Sign In for Pricing
View Details
AFP Antibody - middle region
OAAB01177-400UL 400 µL

AFP Antibody - middle region

Sign In for Pricing
View Details
Cy5.5 HA (MW 7000)
HY-D2658 1 Each

Cy5.5 HA (MW 7000)

Sign In for Pricing
View Details
CASK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV676646 1.0 µg DNA

CASK Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
MMP14 Protein Vector (Human) (pPM-C-HA)
30236021 500 ng

MMP14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MYCLK1 sgRNA CRISPR Lentivector set (Human)
K1372601 3x 1.0 µg

MYCLK1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details