Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q76V12

Expression Region

1-97

Origin

Influenza A virus (strain A/Aichi/2/1968 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TNF-alpha Antibody (6N2E12) [DyLight 488]
NBP2-27351G 0.1 mL

Mouse Monoclonal TNF-alpha Antibody (6N2E12) [DyLight 488]

Sign In for Pricing
View Details
B7H3 (CD276) Human shRNA Plasmid Kit (Locus ID 80381)
TL317545 1 Kit

B7H3 (CD276) Human shRNA Plasmid Kit (Locus ID 80381)

Sign In for Pricing
View Details
Rabbit anti-human Carcinoembryonic antigen-related cell adhesion molecule 3 polyclonal Antibody(CEACAM3)
MBS1494011-01 0.05 mL

Rabbit anti-human Carcinoembryonic antigen-related cell adhesion molecule 3 polyclonal Antibody(CEACAM3)

Sign In for Pricing
View Details
Rabbit anti-human Carcinoembryonic antigen-related cell adhesion molecule 3 polyclonal Antibody(CEACAM3)
MBS1494011-02 0.1 mL

Rabbit anti-human Carcinoembryonic antigen-related cell adhesion molecule 3 polyclonal Antibody(CEACAM3)

Sign In for Pricing
View Details
Rabbit anti-human Carcinoembryonic antigen-related cell adhesion molecule 3 polyclonal Antibody(CEACAM3)
MBS1494011-03 5x 0.1 mL

Rabbit anti-human Carcinoembryonic antigen-related cell adhesion molecule 3 polyclonal Antibody(CEACAM3)

Sign In for Pricing
View Details
Rat IgG2b Kappa Isotype Control Monoclonal Clone LTF2 APC 100ug
IRTIGG2BKICLTF2CAPC100UG 100 µg

Rat IgG2b Kappa Isotype Control Monoclonal Clone LTF2 APC 100ug

Sign In for Pricing
View Details