Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q77GW2

Expression Region

1-97

Origin

Influenza A virus (strain A/Beijing/353/1989 H3N2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLK RGPSTEGVPESMREEYRKEQQNAVDADDSHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akap7 AAV siRNA Pooled Vector
11657166 1.0 µg

Akap7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
C1orf43 siRNA (Human)
CRH8583-01 15 nmol

C1orf43 siRNA (Human)

Sign In for Pricing
View Details
C1orf43 siRNA (Human)
CRH8583-02 30 nmol

C1orf43 siRNA (Human)

Sign In for Pricing
View Details
AQP9 Antibody
orb3161388-01 50 µL

AQP9 Antibody

Sign In for Pricing
View Details
AQP9 Antibody
orb3161388-02 100 µL

AQP9 Antibody

Sign In for Pricing
View Details
Recombinant Crystallin Gamma S (CRYgS)
MBS2029680-01 0.01 mg

Recombinant Crystallin Gamma S (CRYgS)

Sign In for Pricing
View Details